RRAS Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09347

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat RRAS (NP_001101951). Peptide sequence ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RRAS Antibody - BSA Free

Western Blot: RRAS Antibody [NBP3-09347]

Western Blot: RRAS Antibody [NBP3-09347]

Western Blot: RRAS Antibody [NBP3-09347] - Western blot analysis of RRAS in Rat Stomach lysates. Antibody dilution at 1.0ug/ml

Applications for RRAS Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RRAS

R-Ras is a member of the Ras superfamily of GTPases. Ras proteins function as signaling focal points that are activated by convergent signaling pathways intiated by extracellular stimuli (reviewed in Mitin et al, 2005). Activated Ras proteins in turn regulate a diversity of downstream cytoplasmic signaling cascades. Many members of the Ras superfamily are implicated in the regulation of hematopoietic cells, with roles in growth, survival, differentiation, cytokine production, chemotaxis, vesicle-trafficking, and phagocytosis. The Ras superfamily of proteins includes over 150 small GTPases (distinguished from the large, heterotrimeric GTPases, the G-proteins). It comprises six subfamilies, the Ras, Rho, Ran, Rab, Arf, and Kir/Rem/Rad subfamilies. They exhibit considerable overall amino acid identities, especially in the regions interacting with the guanine nucleotide exchange factors that catalyze their activation. Recognizes R-Ras; human R-Ras is a 218 amino acid protein.

Alternate Names

Oncogene RRAS, p23, ras-related protein R-Ras, related RAS viral (r-ras) oncogene homolog

Gene Symbol

RRAS

Additional RRAS Products

Product Documents for RRAS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RRAS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RRAS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RRAS Antibody - BSA Free and earn rewards!

Have you used RRAS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...