RXR beta/NR2B2 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25117PEP

Novus Biologicals
Loading...

Key Product Details

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RXR beta/NR2B2

Source: E.coli

Amino Acid Sequence: MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25117It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25117PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RXR beta/NR2B2

Retinoid X receptors (RXRs) are members of the steroid/thyroid hormone receptor superfamily of nuclear receptor proteins which exert their effects by binding to specific DNA response elements, thus regulating gene expression in target cells. The RXR subfamily consists of at least three similar genes, RXR alpha, RXR beta and RXR gamma, all of which control transcription of target genes mediated by retinoids. RXR beta controls expression of many genes that respond to hormones and vitamins, including thyroid hormone, estrogen, retinoids and vitamin D. RXR beta controls a wide array of genes because of its ability to heterodimerize with other hormone receptors including the thyroid hormone receptor (THR), vitamin D receptor (VDR) and retinoic acid receptor (RAR).

Long Name

Retinoid X Receptor, beta

Alternate Names

H-2RIIBP, NR2B2, RXRB

Gene Symbol

RXRB

Additional RXR beta/NR2B2 Products

Product Documents for RXR beta/NR2B2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RXR beta/NR2B2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for RXR beta/NR2B2 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review RXR beta/NR2B2 Recombinant Protein Antigen and earn rewards!

Have you used RXR beta/NR2B2 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...