SEH1L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83510

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SEH1L Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEH1L. Peptide sequence: FDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SEH1L Antibody - BSA Free

Western Blot: SEH1L Antibody [NBP2-83510]

Western Blot: SEH1L Antibody [NBP2-83510]

Western Blot: SEH1L Antibody [NBP2-83510] - Host: Rabbit. Target Name: SEH1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for SEH1L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEH1L

SEH1L is encoded by this gene is part of a nuclear pore complex, Nup107-160. This protein contains WD repeats and shares 34% amino acid identity with yeast Seh1 and 30% identity with yeast Sec13. All constituents of the Nup107-160 complex, including this protein, specifically localize to kinetochores in mitosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Transcript Variant: This variant (2) has an additonal segment in the 3' coding region, as compared to variant 1. The encoded isoform 2 has a shorter and distinct C-terminus, as compared to isoform 1.

Alternate Names

nucleoporin SEH1, Nup107-160 subcomplex subunit SEH1, sec13 like protein, SEC13LSEC13-like protein, SEH1, SEH1A, SEH1B, SEH1-like (S. cerevisiae)

Gene Symbol

SEH1L

Additional SEH1L Products

Product Documents for SEH1L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SEH1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEH1L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEH1L Antibody - BSA Free and earn rewards!

Have you used SEH1L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies