SETD5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38257

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SETD5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SETD5 Antibody [NBP2-38257]

Immunocytochemistry/ Immunofluorescence: SETD5 Antibody [NBP2-38257]

Immunocytochemistry/Immunofluorescence: SETD5 Antibody [NBP2-38257] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257]

Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257]

Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257]

Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257]

Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257]

Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257]

Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257] - Staining of human endometrium shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257]

Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257]

Immunohistochemistry-Paraffin: SETD5 Antibody [NBP2-38257] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.
SETD5 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: SETD5 Antibody - BSA Free [NBP2-38257]

Chromatin Immunoprecipitation-exo-Seq: SETD5 Antibody - BSA Free [NBP2-38257]

ChIP-Exo-Seq composite graph for Anti-SETD5 (NBP2-38257) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for SETD5 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SETD5

Alternate Names

DKFZp686J18276, FLJ10707, KIAA1757, SET domain containing 5, SET domain-containing protein 5

Gene Symbol

SETD5

UniProt

Additional SETD5 Products

Product Documents for SETD5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SETD5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SETD5 Antibody - BSA Free

Customer Reviews for SETD5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SETD5 Antibody - BSA Free and earn rewards!

Have you used SETD5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...