SF3B14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57226

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SF3B14(splicing factor 3B, 14 kDa subunit) The peptide sequence was selected from the N terminal of SF3B14. Peptide sequence MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SF3B14 Antibody - BSA Free

Western Blot: SF3B14 Antibody [NBP1-57226]

Western Blot: SF3B14 Antibody [NBP1-57226]

Western Blot: SF3B14 Antibody [NBP1-57226] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Applications for SF3B14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SF3B14

SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site. This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.

Alternate Names

HSPC175, Ht006, P14, pre-mRNA branch site protein p14, SAP14, SF3b 14 kDa subunit, SF3B14a, spliceosome-associated protein, 14 kDa subunit, splicing factor 3B, 14 kDa subunit

Gene Symbol

SF3B6

UniProt

Additional SF3B14 Products

Product Documents for SF3B14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SF3B14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SF3B14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SF3B14 Antibody - BSA Free and earn rewards!

Have you used SF3B14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...