SLC19A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88285

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC19A2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of SLC19A2. Peptide sequence: LGLEITTQFLIYASYFALIAVVFLASGAVSVMKKCRKLEDPQSSSQVTTS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC19A2 Antibody - BSA Free

Western Blot: SLC19A2 Antibody [NBP2-88285]

Western Blot: SLC19A2 Antibody [NBP2-88285]

Western Blot: SLC19A2 Antibody [NBP2-88285] - WB Suggested Anti-SLC19A2 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Heart

Applications for SLC19A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC19A2

SLC19A2 encodes the thiamin transporter protein. Mutations in this gene cause thiamin-responsive megaloblastic anemia syndrome (TRMA), which is an autosomal recessive disorder characterized by diabetes mellitus, megaloblastic anemia and sensorineural deafness.

Alternate Names

high affinity thiamine transporter, reduced folate carrier protein (RFC) like, solute carrier family 19 (thiamine transporter), member 2, Solute carrier family 19 member 2, TC1, Thiamine carrier 1, thiamine transporter 1, THT1, ThTr1, ThTr-1, THTR1thTr-1, TRMA

Gene Symbol

SLC19A2

Additional SLC19A2 Products

Product Documents for SLC19A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC19A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC19A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC19A2 Antibody - BSA Free and earn rewards!

Have you used SLC19A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies