SLC19A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69703

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC19A3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC19A3(solute carrier family 19, member 3) The peptide sequence was selected from the middle region of SLC19A3 (NP_079519). Peptide sequence FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC19A3 Antibody - BSA Free

Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703]

SLC19A3-Antibody-Western-Blot-NBP1-69703-img0006.jpg
Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703] - This Anti-SLC19A3 antibody was used in Western Blot of DU145 tissue lysate at a concentration of 1ug/ml.
Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703]

Western Blot: SLC19A3 Antibody [NBP1-69703] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

Applications for SLC19A3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC19A3

SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Thiamine transporter 2

Alternate Names

ThTr-2, ThTr2

Entrez Gene IDs

80704 (Human)

Gene Symbol

SLC19A3

UniProt

Q9BZV2 (Human)

Additional SLC19A3 Products

Product Documents for SLC19A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC19A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLC19A3 Antibody - BSA Free

Customer Reviews for SLC19A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC19A3 Antibody - BSA Free and earn rewards!

Have you used SLC19A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies