SLC25A25 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88290

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC25A25 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE SLC25A25. Peptide sequence: MSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC25A25 Antibody - BSA Free

Western Blot: SLC25A25 Antibody [NBP2-88290]

Western Blot: SLC25A25 Antibody [NBP2-88290]

Western Blot: SLC25A25 Antibody [NBP2-88290] - Host: Rabbit. Target Name: Slc25a25. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

Applications for SLC25A25 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC25A25

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites,nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediatesthe transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into orfrom the mitochondria

Alternate Names

APC3, calcium-binding mitochondrial carrier protein SCaMC-2, KIAA1896RP11-395P17.4, MCSC, MCSC3, MGC105138, MGC119514, MGC119515, MGC119516, MGC119517, Mitochondrial ATP-Mg/Pi carrier protein 3, Mitochondrial Ca(2+)-dependent solute carrier protein 3, mitochondrial Ca2+-dependent solute carrier, PCSCL, SCAMC2, SCAMC-2, short calcium-binding mitochondrial carrier 2, small calcium-binding mitochondrial carrier 2, Small calcium-binding mitochondrial carrier protein 2, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25, Solute carrier family 25 member 25, solute carrier family 25, member 25

Gene Symbol

SLC25A25

Additional SLC25A25 Products

Product Documents for SLC25A25 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC25A25 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A25 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A25 Antibody - BSA Free and earn rewards!

Have you used SLC25A25 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies