SLC25A31 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59561

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC25A31 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC25A31(solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31) The peptide sequence was selected from the N terminal of SLC25A31. Peptide sequence LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC25A31 Antibody - BSA Free

Western Blot: SLC25A31 Antibody [NBP1-59561]

Western Blot: SLC25A31 Antibody [NBP1-59561]

Western Blot: SLC25A31 Antibody [NBP1-59561] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for SLC25A31 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC25A31

Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions.Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions (Dolce et al., 2005 [PubMed 15670820]).[supplied by OMIM].

Alternate Names

AAC4DKFZp434N1235, adenine nucleotide translocase 4, Adenine nucleotide translocator 4, ADP, ADP/ATP translocase 4, ANT 4, ANT4DKFZP434N1235, ATP carrier protein 4, SFEC, SFEC35kDa, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 31, Solute carrier family 25 member 31, Sperm flagellar energy carrier protein

Gene Symbol

SLC25A31

UniProt

Q9H0C2 (Human)

Additional SLC25A31 Products

Product Documents for SLC25A31 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC25A31 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A31 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A31 Antibody - BSA Free and earn rewards!

Have you used SLC25A31 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies