SLC38A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83554

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC38A2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC38A2. Peptide sequence: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC38A2 Antibody - BSA Free

Western Blot: SLC38A2 Antibody [NBP2-83554]

Western Blot: SLC38A2 Antibody [NBP2-83554]

Western Blot: SLC38A2 Antibody [NBP2-83554] - Host: Rabbit. Target Name: SLC38A2. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: SLC38A2 Antibody [NBP2-83554]

Western Blot: SLC38A2 Antibody [NBP2-83554]

Western Blot: SLC38A2 Antibody [NBP2-83554] - Host: Rabbit. Target Name: SLC38A2. Sample Tissue: Human HepG2. Antibody Dilution: 1.0ug/ml
Western Blot: SLC38A2 Antibody [NBP2-83554]

Western Blot: SLC38A2 Antibody [NBP2-83554]

Western Blot: SLC38A2 Antibody [NBP2-83554] - Host: Rabbit. Target Name: SLC38A2. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml

Applications for SLC38A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC38A2

SLC38A2 functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood-brain b

Alternate Names

Amino acid transporter A2, ata2, ATA2System A transporter 1, KIAA1382System N amino acid transporter 2, pro1068, Protein 40-9-1, sat2, SAT2PRO1068, snat2, SNAT2amino acid transporter 2, sodium-coupled neutral amino acid transporter 2, Solute carrier family 38 member 2, solute carrier family 38, member 2, System A amino acid transporter 2

Gene Symbol

SLC38A2

Additional SLC38A2 Products

Product Documents for SLC38A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC38A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC38A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC38A2 Antibody - BSA Free and earn rewards!

Have you used SLC38A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies