SLC45A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59786

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SLC45A2. Peptide Sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC45A2 Antibody - BSA Free

Western Blot: SLC45A2 Antibody [NBP1-59786]

Western Blot: SLC45A2 Antibody [NBP1-59786]

Western Blot: SLC45A2 Antibody [NBP1-59786] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC45A2 Antibody [NBP1-59786]

Western Blot: SLC45A2 Antibody [NBP1-59786]

Western Blot: SLC45A2 Antibody [NBP1-59786] - Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate.
Western Blot: SLC45A2 Antibody [NBP1-59786]

Western Blot: SLC45A2 Antibody [NBP1-59786]

Western Blot: SLC45A2 Antibody [NBP1-59786] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC45A2 Antibody [NBP1-59786]

Western Blot: SLC45A2 Antibody [NBP1-59786]

Western Blot: SLC45A2 Antibody [NBP1-59786] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for SLC45A2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC45A2

SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.The protein encoded by this gene encodes a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

AIM-1, AIM11A1, MATPmembrane associated transporter, Melanoma antigen AIM1, membrane-associated transporter protein, Protein AIM-1, SHEP5, Solute carrier family 45 member 2, solute carrier family 45, member 2, underwhite

Gene Symbol

SLC45A2

UniProt

Additional SLC45A2 Products

Product Documents for SLC45A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC45A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC45A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC45A2 Antibody - BSA Free and earn rewards!

Have you used SLC45A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...