SLC7A5/LAT1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-09988
Loading...
Key Product Details
Species Reactivity
Validated:
Mouse
Cited:
Mouse
Applications
Validated:
Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse SLC7A5/LAT1 (NP_003477.4). Peptide sequence IAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLC
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for SLC7A5/LAT1 Antibody - BSA Free
Western Blot: SLC7A5/LAT1 Antibody [NBP3-09988]
Western Blot: SLC7A5/LAT1 Antibody [NBP3-09988] - Western blot analysis of SLC7A5/LAT1 in Mouse Brain lysates. Antibody dilution at 1.0ug/mlWestern Blot: SLC7A5/LAT1 Antibody - BSA Free [NBP3-09988] -
Effect of GW501516 on BCAA transport and catabolic enzymes. (a and b) Effect of treatment with GW501516 (GW) at 1 μM for 24 hours on (a) absolute media BCAA content or (b) control mean-normalized (within each experiment) media BCAA content following 24-hour treatment. (c) Effect of GW at 1 μM for up to 24 hours on myotube mRNA expression of branched-chain aminotransferase 2 (Bcat2), branched-chain alpha-keto acid dehydrogenase (Bckdha), and 3-hydroxyisobutyrate dehydrogenase (Hibadh). (d) Effect of GW at 1 μM for 24 hours on myotube protein expression of large amino acid transporter 1 (LAT1), pBCKDHa (normalized to total BCKDHa), BCKDHa, and BCAT2. Notes: ∗ indicates p ≤ 0.05 between groups. Time course gene expression was analyzed using one-way ANOVA with Dunnett's correction for multiple comparisons. Target gene expression was normalized to tata binding protein (Tbp) using three replicates per group across two independent experiments with n = 5–6 for the final analysis. Protein expression and BCAA media content were analyzed using student's t-test. Western blots were performed using three replicates per group across two independent experiments with n = 6 for the final analysis. BCAA media content was performed using three replicates per group across two independent experiments with n = 6 for the final analysis with each analyte measured in triplicate. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37325367), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SLC7A5/LAT1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLC7A5/LAT1
Long Name
Solute Carrier Family 7 Member 5
Alternate Names
4F2LC, CD98lc, E16, LAT1, MPE16, TA1
Gene Symbol
SLC7A5
Additional SLC7A5/LAT1 Products
Product Documents for SLC7A5/LAT1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC7A5/LAT1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SLC7A5/LAT1 Antibody - BSA Free
Customer Reviews for SLC7A5/LAT1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLC7A5/LAT1 Antibody - BSA Free and earn rewards!
Have you used SLC7A5/LAT1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...