SLITRK2 (Slit and Trk-like family member 2) is a transmembrane protein that is expressed in multiple regions of the brain, particularly the cerebral cortex and hippocampus. It can suppress neurite outgrowth and promote the formation of excitatory and inhibitory presynaptic structures. The synaptogenic function is dependent on the interaction of SLITRK2 with select isoforms of PTP-sigma. In humans, mutations of SLITRK6 are associated with bipolar disorder and schizophrenia.
SLITRK2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-82346
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SLITRK2. Peptide sequence: YNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPNHPLLQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for SLITRK2 Antibody - BSA Free
Western Blot: SLITRK2 Antibody [NBP2-82346]
Western Blot: SLITRK2 Antibody [NBP2-82346] - Host: Rabbit. Target Name: SLITRK2. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/mlApplications for SLITRK2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLITRK2
Long Name
SLIT and NTRK-like Family, Member 2
Alternate Names
CXorf2, SLITL1
Gene Symbol
SLITRK2
Additional SLITRK2 Products
Product Documents for SLITRK2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLITRK2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SLITRK2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLITRK2 Antibody - BSA Free and earn rewards!
Have you used SLITRK2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...