SMR3B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84270

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SMR3B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of SMR3B. Peptide sequence: PYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SMR3B Antibody - BSA Free

Western Blot: SMR3B Antibody [NBP2-84270]

Western Blot: SMR3B Antibody [NBP2-84270]

Western Blot: SMR3B Antibody [NBP2-84270] - Host: Rabbit. Target Name: SMR3B. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml

Applications for SMR3B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMR3B

SMR3B, also known as Submaxillary gland androgen-regulated protein 3B, is a 79 amino acid protein that is 8 kDa, secreted into saliva by submaxillary gland. Little is currently known about SMR3B protein function. The protein is being studied for its involvement in pancytopenia. Interactions with SMR3B protein have shown to involve MUC7, EIF4A2, ATP1B3, TNPO2, UBE4A, ATAD3A, MSH2, TTC27, KIAA1279, RAB3GAP2, USO1, PTP4A3, CNNM3, and other proteins.

Alternate Names

P-B, PBIIMGC104379, PRL3submaxillary gland androgen regulated protein 3 homolog B (mouse), PROL3, proline rich 3, Proline-rich peptide P-B, Proline-rich protein 3, salivary proline-rich protein, SMR1B, submaxillary gland androgen regulated protein 3 homolog B, submaxillary gland androgen regulated protein 3B, submaxillary gland androgen-regulated protein 3B

Gene Symbol

SMR3B

Additional SMR3B Products

Product Documents for SMR3B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMR3B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMR3B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMR3B Antibody - BSA Free and earn rewards!

Have you used SMR3B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies