SMUG1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52981

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SMUG1(single-strand-selective monofunctional uracil-DNA glycosylase 1) The peptide sequence was selected from the middle region of SMUG1. Peptide sequence IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SMUG1 Antibody - BSA Free

Western Blot: SMUG1 Antibody [NBP1-52981]

Western Blot: SMUG1 Antibody [NBP1-52981]

Western Blot: SMUG1 Antibody [NBP1-52981] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for SMUG1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMUG1

SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Single-strand Selective Monofunctional Uracil DNA Glycosylase 1

Alternate Names

EC 3.2.2, EC 3.2.2.-, FDG, HMUDG, MGC104370, single-strand selective monofunctional uracil DNA glycosylase, single-strand-selective monofunctional uracil-DNA glycosylase 1, UNG3

Gene Symbol

SMUG1

UniProt

Additional SMUG1 Products

Product Documents for SMUG1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMUG1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for SMUG1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMUG1 Antibody - BSA Free and earn rewards!

Have you used SMUG1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for SMUG1 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: What is the lysis buffer used for the WB of SMUG1?

    A: In the WB validation testing of NBP1-52981, the lysis buffer used for generating test samples was follows: Cell Lysis Buffer (1% NP40, 0.5% DOC, 1mM EDTA, 65mM Tri s-HCl pH=6.4, 1mM PMSF, 1ug/ml Apoprotin, 1ug/ml L e upeptin, 1ug/ml Pepstatin).

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...