SNRPD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57174

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SNRPD2(small nuclear ribonucleoprotein D2 polypeptide 16.5kDa) The peptide sequence was selected from the middle region of SNRPD2. Peptide sequence ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SNRPD2 Antibody - BSA Free

Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174] - Human Jurkat, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174] - Human 293T, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in HEK293T.
Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174] - Human Hela, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174]

Western Blot: SNRPD2 Antibody [NBP1-57174] - Human MCF7, Antibody Dilution: 1.0 ug/ml SNRPD2 is supported by BioGPS gene expression data to be expressed in MCF7.

Applications for SNRPD2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNRPD2

SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis.The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Alternate Names

small nuclear ribonucleoprotein D2 polypeptide (16.5kD), small nuclear ribonucleoprotein D2 polypeptide 16.5kDa, small nuclear ribonucleoprotein Sm D2, Sm-D2SMD2, snRNP core protein D2, SNRPD1

Gene Symbol

SNRPD2

Additional SNRPD2 Products

Product Documents for SNRPD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SNRPD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SNRPD2 Antibody - BSA Free

Customer Reviews for SNRPD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNRPD2 Antibody - BSA Free and earn rewards!

Have you used SNRPD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...