SNURPORTIN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57132

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SNURPORTIN1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SNUPN(snurportin 1) The peptide sequence was selected from the middle region of SNUPN. Peptide sequence GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SNURPORTIN1 Antibody - BSA Free

Western Blot: SNURPORTIN1 Antibody [NBP1-57132]

Western Blot: SNURPORTIN1 Antibody [NBP1-57132]

Western Blot: SNURPORTIN1 Antibody [NBP1-57132] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for SNURPORTIN1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNURPORTIN1

The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. SNUPN interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor.The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. The protein encoded by this gene interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor. Alternatively spliced transcript variants encoding the same protein have been identified for this gene.

Alternate Names

KPNBL, RNA U transporter 1, RNA, U transporter 1, RNUT1, snurportin 1, Snurportin1, snurportin-1, SPN1

Gene Symbol

SNUPN

UniProt

O95149 (Human)

Additional SNURPORTIN1 Products

Product Documents for SNURPORTIN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SNURPORTIN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNURPORTIN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNURPORTIN1 Antibody - BSA Free and earn rewards!

Have you used SNURPORTIN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies