SOHLH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56454

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SOHLH1(spermatogenesis and oogenesis specific basic helix-loop-helix 1) The peptide sequence was selected from the middle region of SOHLH1. Peptide sequence EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SOHLH1 Antibody - BSA Free

Western Blot: SOHLH1 Antibody [NBP1-56454]

Western Blot: SOHLH1 Antibody [NBP1-56454]

Western Blot: SOHLH1 Antibody [NBP1-56454] - Hela cell lysate, concentration 0.2-1 ug/ml.
SOHLH1 Antibody - BSA Free

Western Blot: SOHLH1 Antibody - BSA Free [NBP1-56454] -

Sohlh1 promotes the differentiation of GSLCs. (A) U87MG and U251 GSLCs were cultured in medium containing 1% serum for 8 h. Representative images of induced differentiation of Sohlh1 overexpression and Sohlh1 knockdown in U87MG and U251 GSLCs. Scale bars indicate 100 μm. q‐PCR (B) and Western‐blot (C, D) were performed to detect the expression of GSLC differentiation‐related genes, including MAP2, GFAP and MBP. (E, F) Representative IF images of MAP2 and GFAP in differentiated spheroids of Sohlh1 overexpression and Sohlh1 knockdown in U87MG and U251 GSLCs. Scale bars indicate 100 μm. Statistical results were calculated using a two‐tailed Student's t test. *p < 0.05, **p < 0.01, ***p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40418209), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SOHLH1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SOHLH1

SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.

Alternate Names

bA100C15.3, bHLHe80, C9orf157, NOHLHchromosome 9 open reading frame 157, spermatogenesis and oogenesis specific basic helix-loop-helix 1, spermatogenesis- and oogenesis-specific basic helix-loop-helix-containingprotein 1, TEB2newborn ovary helix loop helix

Gene Symbol

SOHLH1

Additional SOHLH1 Products

Product Documents for SOHLH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SOHLH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SOHLH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SOHLH1 Antibody - BSA Free and earn rewards!

Have you used SOHLH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...