SOHLH1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-56454
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to SOHLH1(spermatogenesis and oogenesis specific basic helix-loop-helix 1) The peptide sequence was selected from the middle region of SOHLH1.
Peptide sequence EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for SOHLH1 Antibody - BSA Free
Western Blot: SOHLH1 Antibody [NBP1-56454]
Western Blot: SOHLH1 Antibody [NBP1-56454] - Hela cell lysate, concentration 0.2-1 ug/ml.Western Blot: SOHLH1 Antibody - BSA Free [NBP1-56454] -
Sohlh1 promotes the differentiation of GSLCs. (A) U87MG and U251 GSLCs were cultured in medium containing 1% serum for 8 h. Representative images of induced differentiation of Sohlh1 overexpression and Sohlh1 knockdown in U87MG and U251 GSLCs. Scale bars indicate 100 μm. q‐PCR (B) and Western‐blot (C, D) were performed to detect the expression of GSLC differentiation‐related genes, including MAP2, GFAP and MBP. (E, F) Representative IF images of MAP2 and GFAP in differentiated spheroids of Sohlh1 overexpression and Sohlh1 knockdown in U87MG and U251 GSLCs. Scale bars indicate 100 μm. Statistical results were calculated using a two‐tailed Student's t test. *p < 0.05, **p < 0.01, ***p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40418209), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SOHLH1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SOHLH1
Alternate Names
bA100C15.3, bHLHe80, C9orf157, NOHLHchromosome 9 open reading frame 157, spermatogenesis and oogenesis specific basic helix-loop-helix 1, spermatogenesis- and oogenesis-specific basic helix-loop-helix-containingprotein 1, TEB2newborn ovary helix loop helix
Gene Symbol
SOHLH1
Additional SOHLH1 Products
Product Documents for SOHLH1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SOHLH1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SOHLH1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SOHLH1 Antibody - BSA Free and earn rewards!
Have you used SOHLH1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...