Somatostatin R3/SSTR3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10032

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Somatostatin R3/SSTR3 (NP_001042.1). Peptide sequence GGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTM

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Somatostatin R3/SSTR3 Antibody - BSA Free

Western Blot: Somatostatin R3/SSTR3 Antibody [NBP3-10032]

Western Blot: Somatostatin R3/SSTR3 Antibody [NBP3-10032]

Western Blot: Somatostatin R3/SSTR3 Antibody [NBP3-10032] - Western blot analysis of Somatostatin R3/SSTR3 in Human Jurkat Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for Somatostatin R3/SSTR3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Somatostatin R3/SSTR3

Expression of Somatostatin Receptor Type 3 (SSTR3) has been reported in brain, breast, eye, gastrointestinal tract, pancreas, and thyroid. G-protein Coupled Receptors (GPCRs) comprise one of the largest families of signaling molecules with more than a thousand members currently predicted to exist. All GPCRs share a structural motif consisting of seven membrane-spanning helices, and exist in both active and inactive forms. An array of activating ligands participate in the conformation of GPCRs which leads to signaling via G-proteins and downstream effectors. Ongoing studies have also shown the vast series of reactions which participate in the negative regulation of GPCRs. This "turn-off" activity has tremendous implications for the physiological action of the cell, and continues to drive pharmacological research for new drug candidates. Two blockbuster drugs which have been developed as GPCR-targeted pharmaceuticals are Zyprexa (Eli Lilly) and Claritin (Schering-Plough) which have multi-billion dollar shares of the mental health and allergy markets, respectively.

Long Name

Somatostatin Receptor Type 3

Alternate Names

SomatostatinR3, SSR-28, SST3, SSTR3

Gene Symbol

SSTR3

Additional Somatostatin R3/SSTR3 Products

Product Documents for Somatostatin R3/SSTR3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Somatostatin R3/SSTR3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Somatostatin R3/SSTR3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Somatostatin R3/SSTR3 Antibody - BSA Free and earn rewards!

Have you used Somatostatin R3/SSTR3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...