Spectrin alpha 1 Antibody (1U5K4)

Novus Biologicals | Catalog # NBP3-16833

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1U5K4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 2300-2400 of human Spectrin alpha 1 (P02549). LRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Spectrin alpha 1 Antibody (1U5K4)

Western Blot: Spectrin alpha 1 Antibody (1U5K4) [NBP3-16833]

Western Blot: Spectrin alpha 1 Antibody (1U5K4) [NBP3-16833]

Western Blot: Spectrin alpha 1 Antibody (1U5K4) [NBP3-16833] - Western blot analysis of extracts of various cell lines, using Spectrin alpha 1 Rabbit mAb (NBP3-16833) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for Spectrin alpha 1 Antibody (1U5K4)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Spectrin alpha 1

Spectrin is a major constituent of the erythrocyte skeleton accounting for 25% of the total membrane protein and 75% of the cytoskeletal mass. It is associated with the cytoplasmic surface of the membrane by attachment to ankyrin, a peripheral membrane protein. The membrane skeleton influences several cellular properties such as cell shape, restriction of mobility of the integral membrane protein exposed at the cell surface and transmembrane movement of phospholipids and cholesterol. On SDS PAGE gels erythrocyte spectrin appears as two bands referred to as alpha (240 kDa) and beta (220 kDa). While the simplest form of spectrin in solution is an alpha-beta heterodimer, spectrin can undergo self-association in various conditions to form a tetramer of alpha2-beta2. In recent years a large number of spectrin-like molecules have been found in non-erythroid cells. These proteins are known by such different names as fodrin, CBP I, calspectin and TW 260/240.

Alternate Names

alpha-I spectrin, EL2, erythrocyte, HS3, spectrin, alpha, erythrocytic 1 (elliptocytosis 2)

Gene Symbol

SPTA1

Additional Spectrin alpha 1 Products

Product Documents for Spectrin alpha 1 Antibody (1U5K4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Spectrin alpha 1 Antibody (1U5K4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Spectrin alpha 1 Antibody (1U5K4)

There are currently no reviews for this product. Be the first to review Spectrin alpha 1 Antibody (1U5K4) and earn rewards!

Have you used Spectrin alpha 1 Antibody (1U5K4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...