SPIN2A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04731

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all SPIN2A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human SPIN2A (NP_061876.3). MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications for SPIN2A Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:200-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SPIN2A

The SPIN2A gene encodes one of three members of the DXF34 gene family, located in a 100-kb region of chromosome Xp11.21. (provided by RefSeq)

Alternate Names

centromeric spin2 copy, DXF34dJ323P24.1, MGC88670, Protein DXF34, RP3-323P24.2, SPIN2, SPIN-2, SPIN-2A, spindlin family, member 2, spindlin family, member 2A, spindlin homolog 2, spindlin-2A, spindlin-like protein 2, Spindlin-like protein 2A

Gene Symbol

SPIN2A

Additional SPIN2A Products

Product Documents for SPIN2A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SPIN2A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SPIN2A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SPIN2A Antibody - Azide and BSA Free and earn rewards!

Have you used SPIN2A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies