SREB3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93961

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human GPR173 (NP_061842.1). FDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPVQMVPAISQNW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SREB3 Antibody - Azide and BSA Free

Western Blot: SREB3 AntibodyAzide and BSA Free [NBP2-93961]

Western Blot: SREB3 AntibodyAzide and BSA Free [NBP2-93961]

Western Blot: SREB3 Antibody [NBP2-93961] - Analysis of extracts of various cell lines, using SREB3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Applications for SREB3 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SREB3

SREB3, a member of the SREB (Super-Conserved Receptor Expressed in Brain) family of GPCRs, is an Orphan-A GPCR with an unknown ligand. SREB3 has been reported to be expressed in several areas of human and rat CNS (Matsumoto et al., 2000), as well as in genital organs. ESTs have been isolated from lung libraries, as well as cancer libraries of the brain, colon, and lung.

Alternate Names

G protein coupled receptor 173, G protein-coupled receptor 173, G-protein coupled receptor 173, probable G-protein coupled receptor 173, SREB3Super conserved receptor expressed in brain 3

Gene Symbol

GPR173

Additional SREB3 Products

Product Documents for SREB3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SREB3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SREB3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SREB3 Antibody - Azide and BSA Free and earn rewards!

Have you used SREB3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...