Syntaxin 4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69149

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Syntaxin 4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to STX4 (syntaxin 4) The peptide sequence was selected from the middle region of STX4. Peptide sequence LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Syntaxin 4 Antibody - BSA Free

Western Blot: Syntaxin 4 Antibody [NBP1-69149]

Western Blot: Syntaxin 4 Antibody [NBP1-69149]

Western Blot: Syntaxin 4 Antibody [NBP1-69149] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Applications for Syntaxin 4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Syntaxin 4

STX4 is a plasma membrane t-SNARE that mediates docking of transport vesicles.STX4 is necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, STX4 may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes. STX4 may also play a role in docking of synaptic vesicles at presynaptic active zones.

Alternate Names

NY-REN-31, p35-2, STX4

Gene Symbol

STX4

UniProt

Q12846

Additional Syntaxin 4 Products

Product Documents for Syntaxin 4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Syntaxin 4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for Syntaxin 4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Syntaxin 4 Antibody - BSA Free and earn rewards!

Have you used Syntaxin 4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies