TAF10 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-85867
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human TAF10. Peptide sequence: DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for TAF10 Antibody - BSA Free
Western Blot: TAF10 Antibody [NBP2-85867]
Western Blot: TAF10 Antibody [NBP2-85867] - WB Suggested Anti-TAF10 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysateWestern Blot: TAF10 Antibody [NBP2-85867]
Western Blot: TAF10 Antibody [NBP2-85867] - Host: Mouse. Target Name: TAF10. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/mlApplications for TAF10 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TAF10
Alternate Names
30kDa, STAF28, TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2ATAFII-30, TAF2Htranscription initiation factor TFIID 30 kD subunit, TAFII30TAF(II)30, TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30kD, Transcription initiation factor TFIID 30 kDa subunit, transcription initiation factor TFIID subunit 10
Gene Symbol
TAF10
Additional TAF10 Products
Product Documents for TAF10 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TAF10 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for TAF10 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TAF10 Antibody - BSA Free and earn rewards!
Have you used TAF10 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...