TFAP2D Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-13428PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TFAP2D.

Source: E. coli

Amino Acid Sequence: TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13428.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-13428PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TFAP2D

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements toregulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activategenes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb andneural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC (Bysimilarity)

Alternate Names

Activating enhancer-binding protein 2-delta, AP-2 like, AP2-delta, TFAP2BL1activating enhancer binding protein 2 beta-like 1, transcription factor AP-2 beta (activating enhancer binding protein 2beta)-like 1, transcription factor AP-2 beta (activating enhancer-binding protein 2beta)-like 1, transcription factor AP-2 delta (activating enhancer binding protein 2 delta), Transcription factor AP-2-beta-like 1, transcription factor AP-2-delta

Gene Symbol

TFAP2D

Additional TFAP2D Products

Product Documents for TFAP2D Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TFAP2D Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for TFAP2D Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review TFAP2D Recombinant Protein Antigen and earn rewards!

Have you used TFAP2D Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for TFAP2D Recombinant Protein Antigen

Showing  1 - 11 FAQ Showing All
  • Q: Have any of your TFAP2 antibodies been tested for cross reactivity with the other TFAP2 proteins such as alpha, beta and epsilon? Have they been tested by immunostaining tissue?

    A: A list of our TFAP2D antibodies can be found here. Our products are all guaranteed for the applications and species listed on the datasheet and are not expected to cross-react with any known proteins.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...