TGIF2LX Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10441

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TGIF2LX Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_694749). Peptide sequence RYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TGIF2LX Antibody - BSA Free

Western Blot: TGIF2LX Antibody [NBP3-10441]

Western Blot: TGIF2LX Antibody [NBP3-10441]

Western Blot: TGIF2LX Antibody [NBP3-10441] - Western blot analysis of TGIF2LX in Mouse Muscle as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for TGIF2LX Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TGIF2LX

TGIF2LX encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. [provided by RefSeq]

Alternate Names

homeobox protein TGIF2LX, MGC34726, TGF-beta-induced transcription factor 2-like protein, TGFB-induced factor 2-like protein, X-linked, TGFB-induced factor 2-like, X-linked, TGFB-induced factor homeobox 2-like, X-linked, TGIFLXTGIF-like on the X

Gene Symbol

TGIF2LX

Additional TGIF2LX Products

Product Documents for TGIF2LX Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TGIF2LX Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TGIF2LX Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TGIF2LX Antibody - BSA Free and earn rewards!

Have you used TGIF2LX Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies