THSD1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25189PEP

Novus Biologicals
Loading...

Key Product Details

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human THSD1

Source: E.coli

Amino Acid Sequence: KSQARHVGSRGGPSERSHARNAHFRRTASFHEARQARPFRERSMSTLTPRQAPAYSSRTRTCEQAEDRFRPQSRGAHLFPEKLEHFQEASGTRGPLN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25189It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25189PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: THSD1

Mouse THSD1 (Thrombospondin type-1 domain-containing protein 1), also known as Transmembrane molecule with thrombospondin module (Tmtsp), is a 95 kDa, type I transmembrane protein. It is synthesized as a precursor that is 851 amino acids (aa) in length, and has a 24 aa signal sequence, a 388 aa extracellular region, a 21 aa transmembrane region, and a 418 aa cytoplasmic region. The extracellular region contains six potential N-linked glycosylation sites and the thrombospondin type-1 (TSP1) domain, which is implicated in cell adhesion and migration. Also present in the molecule are 9 PKC-phosphorylation sites, 3 Ig-like domains, and a tyrosine-phosphorylation site by its C-terminus. Mouse THSD1 shares 78% aa sequence identity with human THSD1. THSD1 is highly expressed in hematopoietic stem cells (HSCs) and progenitor cells, including CD34-/lowKit+Sca-1+Lin- HSCs, CD34+Kit+Sca-1+Lin- and Lin- progenitor cells, and to a lesser degree in thymic CD4-CD8- cells. Expression gradually decreases during T cell differentiation. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1's ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand. THSD1 may function in primitive hematopoietic cells in the bone marrow niche, and through its TSP1 and Ig-like domains, it may play a role in HSC homing to the niche following cell-to-cell contact to maintain hematopoietic stem cell quiescence.

Long Name

Thrombospondin, Type I, Domain Containing 1

Alternate Names

TMTSP

Gene Symbol

THSD1

Additional THSD1 Products

Product Documents for THSD1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for THSD1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for THSD1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review THSD1 Recombinant Protein Antigen and earn rewards!

Have you used THSD1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...