Thymidine Kinase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85914

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Thymidine Kinase 2. Peptide sequence: RALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIAS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Thymidine Kinase 2 Antibody - BSA Free

Western Blot: Thymidine Kinase 2 Antibody [NBP2-85914]

Western Blot: Thymidine Kinase 2 Antibody [NBP2-85914]

Western Blot: Thymidine Kinase 2 Antibody [NBP2-85914] - Host: Rabbit. Target Name: TK2. Sample Tissue: Human HCT116 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for Thymidine Kinase 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Thymidine Kinase 2

The mitochondrial deoxyribonucleotide (dNTP) pool is separated from the cytosolic pool because the mitochondria inner membrane is impermeable to charged molecules. The mitochondrial pool is maintained by either import of cytosolic dNTPs through dedicated transporters or by salvaging deoxynucleosides within the mitochondria; apparently, enzymes of the de novo dNTP synthesis pathway are not present in the mitochondria. In nonreplicating cells, where cytosolic dNTP synthesis is downregulated, mtDNA synthesis depends solely on the mitochondrial salvage pathway enzymes, the deoxyribonucleoside kinases. Two of the 4 human deoxyribonucleoside kinases, deoxyguanosine kinase (DGK) and thymidine kinase-2, are expressed in mitochondria. Human DGK, encoded by the DGUOK gene (MIM 601465), efficiently phosphorylates deoxyguanosine and deoxyadenosine, whereas TK2 phosphorylates deoxythymidine, deoxycytidine, and deoxyuridine. Thymidine kinase-2 (TK2) is a deoxyribonucleoside kinase that phosphorylates thymidine, deoxycytidine, and deoxyuridine, and also phosphorylates antiviral and anticancer nucleoside analogs.[supplied by OMIM]

Alternate Names

EC 2.7.1.21, MTDPS2, MTTK, mt-TK, thymidine kinase 2, mitochondrial

Gene Symbol

TK2

Additional Thymidine Kinase 2 Products

Product Documents for Thymidine Kinase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Thymidine Kinase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Thymidine Kinase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Thymidine Kinase 2 Antibody - BSA Free and earn rewards!

Have you used Thymidine Kinase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...