TM2D2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79845

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TM2D2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human TM2D2The immunogen for this antibody is TM2D2. Peptide sequence QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TM2D2 Antibody - BSA Free

Western Blot: TM2D2 Antibody [NBP1-79845]

Western Blot: TM2D2 Antibody [NBP1-79845]

Western Blot: TM2D2 Antibody [NBP1-79845] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for TM2D2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TM2D2

TM2D2 is encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. This gene has multiple alternatively spliced transcript variants which encode two different isoforms. [provided by RefSeq]

Alternate Names

BBP-like protein 1, Beta-amyloid-binding protein-like protein 1, BLP1MGC125814, MGC125813, TM2 domain containing 2, TM2 domain-containing protein 2

Gene Symbol

TM2D2

UniProt

NP_510882 (Human)

Additional TM2D2 Products

Product Documents for TM2D2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TM2D2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TM2D2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TM2D2 Antibody - BSA Free and earn rewards!

Have you used TM2D2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies