TMPRSS11E Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85955

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TMPRSS11E Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMPRSS11E. Peptide sequence: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TMPRSS11E Antibody - BSA Free

Western Blot: TMPRSS11E Antibody [NBP2-85955]

Western Blot: TMPRSS11E Antibody [NBP2-85955]

Western Blot: TMPRSS11E Antibody [NBP2-85955] - Host: Rabbit. Target Name: TMPRSS11E. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Applications for TMPRSS11E Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMPRSS11E

TMPRSS11E is a member of a larger family of membrane attached serine proteases, a poorly defined group that includes TMPRSS11A, B, C, D, E, F, Hepsin, Corin, Matriptase 1, 2 and 3. The highest degree of identity is with TMPRSS11A, which shares 43% identity at the amino acid level. TMPRSS11E has a domain structure of an aminoterminal cytoplasmic domain, followed by a transmembrane domain, a SEA domain (Sea urchin sperm protein, Enterokinase, Agrin), a short spacer, then the trypsin like serine protease domain. The SEA domain is thought to play a role in carbohydrate binding in the analogous protein sequences where it is found, but the role in TMPRSS11E is unclear. The cleavage of the Arg191 Ile192 bond liberates the catalytic domain. TMPRSS11E has been shown to cleave fibronectin, gelatin, casein and pro uPA in vitro, and to form complexes with serpinA5 and serpinE1.

Alternate Names

DESC1, FLJ75331, FLJ94490, MGC141972, MGC141974, serine 11E2, serine protease DESC1, TMPRSS11E2, transmembrane protease serine 11E, transmembrane protease serine 11E2, transmembrane protease, serine 11E, UNQ742/PRO1461

Gene Symbol

TMPRSS11E

Additional TMPRSS11E Products

Product Documents for TMPRSS11E Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMPRSS11E Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMPRSS11E Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMPRSS11E Antibody - BSA Free and earn rewards!

Have you used TMPRSS11E Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies