TRADD Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10286

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TRADD Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRADD (NP_003780). Peptide sequence YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit TRADD Antibody - BSA Free (NBP3-10286) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for TRADD Antibody - BSA Free

Western Blot: TRADD Antibody [NBP3-10286]

Western Blot: TRADD Antibody [NBP3-10286]

Western Blot: TRADD Antibody [NBP3-10286] - Western blot analysis using NBP3-10286 on Human DU145 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for TRADD Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRADD

TRADD [tumor necrosis factor receptor type 1-associated (TNFR1) death domain protein] is a death domain containing adaptor molecule that interacts with TNFR1/TNFRSF1A and mediates programmed cell death signaling and NF-kB activation (reviewed in Feng, 2005). TRADD binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thereby suppresses TRAF2 mediated apoptosis. TRADD can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway. This antibody recognizes TRADD; human TRADD is a 312 amino acid protein.

Long Name

TNFRSF1A-associated via Death Domain

Alternate Names

MGC11078, TNFRSF1A-associated via death domainTNFR1-associated DEATH domain protein, tumor necrosis factor receptor type 1 associated death domain protein, tumor necrosis factor receptor type 1-associated DEATH domain protein, tumor necrosis factor receptor-1-associated protein

Gene Symbol

TRADD

Additional TRADD Products

Product Documents for TRADD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRADD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRADD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRADD Antibody - BSA Free and earn rewards!

Have you used TRADD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Apoptosis Signaling Pathway Apoptosis Signaling Pathway Thumbnail