Transportin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93233

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Transportin 1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 790-890 of human Transportin 1 (NP_002261.3). CPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Transportin 1 Antibody - BSA Free

Western Blot: Transportin 1 AntibodyBSA Free [NBP2-93233]

Western Blot: Transportin 1 AntibodyBSA Free [NBP2-93233]

Western Blot: Transportin 1 Antibody [NBP2-93233] - Analysis of extracts of various cell lines, using Transportin 1. Exposure time: 1s.

Applications for Transportin 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:200-1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Transportin 1

Heterogeneous nuclear ribonucleoprotein hnRNPA1 is an abundant nuclear protein that plays an important role in pre-mRNA processing and mRNA export from the nucleus. A1 shuttles rapidly between the nucleus and the cytoplasm, and a 38-amino acid domain, M9, serves as the bi-directional transport signal of A1. Recently, a 90-kD protein, transportin, was identified as the mediator of A1 nuclear import. Transportin mediates the nuclear import of additional hnRNP proteins, including hnRNPF. The nuclear localization of A1 is dependent on ongoing RNA polymerase II transcription.

Alternate Names

importin beta 2, Importin beta-2, IPO2, karyopherin (importin) beta 2, MIP1Karyopherin beta-2, MIPM9 region interaction protein, transportin 1, transportin-1, TRNKPNB2importin 2

Gene Symbol

TNPO1

Additional Transportin 1 Products

Product Documents for Transportin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Transportin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Transportin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Transportin 1 Antibody - BSA Free and earn rewards!

Have you used Transportin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies