TRAR4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86872

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAR4. Peptide sequence: ENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLID The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TRAR4 Antibody - BSA Free

Western Blot: TRAR4 Antibody [NBP2-86872]

Western Blot: TRAR4 Antibody [NBP2-86872]

Western Blot: TRAR4 Antibody [NBP2-86872] - Host: Rabbit. Target Name: TAAR6. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for TRAR4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRAR4

FUNCTION: Orphan receptor. Could be a receptor for trace amines. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed at low abundance in various brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression in basal ganglia, frontal cortex, substantia nigra, amygdala and hippocampus, highest expression in hippocampus and lowest expression in basal ganglia.

Alternate Names

RP11-295F4.3, TA4taR-6, TAR4, TaR-4, TAR6, TaR-6, trace amine associated receptor 6, Trace amine receptor 4taR-4, Trace amine receptor 6, TRAR4trace amine-associated receptor 6

Gene Symbol

TAAR6

Additional TRAR4 Products

Product Documents for TRAR4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRAR4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRAR4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRAR4 Antibody - BSA Free and earn rewards!

Have you used TRAR4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...