Treacher Collins syndrome protein Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88463

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Treacher Collins syndrome protein Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Treacher Collins syndrome protein. Peptide sequence: MAEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Treacher Collins syndrome protein Antibody - BSA Free

Western Blot: Treacher Collins syndrome protein Antibody [NBP2-88463]

Western Blot: Treacher Collins syndrome protein Antibody [NBP2-88463]

Western Blot: Treacher Collins syndrome protein Antibody [NBP2-88463] - Host: Rabbit. Target Name: TCOF. Sample Type: HCT116 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Treacher Collins syndrome protein Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Treacher Collins syndrome protein

This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Multiple transcript variants encoding different isoforms have been found for this gene

Alternate Names

MFD1, nucleolar trafficking phosphoprotein, TCS1, Treacher Collins syndrome protein, Treacher Collins-Franceschetti syndrome 1, treacle, treacle protein

Gene Symbol

TCOF1

Additional Treacher Collins syndrome protein Products

Product Documents for Treacher Collins syndrome protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Treacher Collins syndrome protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Treacher Collins syndrome protein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Treacher Collins syndrome protein Antibody - BSA Free and earn rewards!

Have you used Treacher Collins syndrome protein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies