Troponin C (cardiac) Antibody (8Z4V9)

Novus Biologicals | Catalog # NBP3-16280

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8Z4V9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Troponin C (cardiac) (P63316). MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Troponin C (cardiac) Antibody (8Z4V9)

Western Blot: Troponin C (cardiac) Antibody (8Z4V9) [NBP3-16280]

Western Blot: Troponin C (cardiac) Antibody (8Z4V9) [NBP3-16280]

Western Blot: Troponin C (cardiac) Antibody (8Z4V9) [NBP3-16280] - Western blot analysis of extracts of various cell lines, using Troponin C (cardiac) antibody (NBP3-16280) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for Troponin C (cardiac) Antibody (8Z4V9)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Troponin C (cardiac)

Troponin I is part of a heteromeric complex playing an important role in the regulation of skeletal and cardiac muscle contraction. It consists of three subunits, troponin I (TnI), troponin T (TnT) and troponin C (TnC). Each subunit is responsible for part of troponin complex function. TnI inhibits ATPase activity of acto myosin and TnT and TnI are present in cardiac muscles in different forms than in skeletal muscles. Only one tissue specific isoform of TnI is described for cardiac muscle tissue (cTnI) and this is expressed only in myocardium.

Alternate Names

cardiac troponin C, CMD1Z, CMH13, slow twitch skeletal/cardiac muscle troponin C, TNC, TN-C, TNNC, troponin C type 1 (slow), troponin C, slow, troponin C, slow skeletal and cardiac muscles, troponin C1, slow

Gene Symbol

TNNC1

Additional Troponin C (cardiac) Products

Product Documents for Troponin C (cardiac) Antibody (8Z4V9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Troponin C (cardiac) Antibody (8Z4V9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Troponin C (cardiac) Antibody (8Z4V9)

There are currently no reviews for this product. Be the first to review Troponin C (cardiac) Antibody (8Z4V9) and earn rewards!

Have you used Troponin C (cardiac) Antibody (8Z4V9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...