Recombinant Human Tryptase alpha/beta 1 His Protein

Novus Biologicals | Catalog # NBP2-22894

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Accession Number

Tag

His

Applications

SDS-PAGE
Loading...

Product Specifications

Description

A denatured recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 31-275 of Human Tryptase alpha/beta 1 (Uniprot: Q15661)

Source: E.coli

Amino Acid Sequence: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

Purity

>85%, by SDS-PAGE

Predicted Molecular Mass

30.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Application Notes

Denatured protein is most likely not the best option for functional studies. It is better suited for Western Blot (WB) or imaging assays.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Tryptase alpha/beta 1 His Protein

SDS-PAGE: Recombinant Human Tryptase alpha/beta 1 His Protein [NBP2-22894]

SDS-PAGE: Recombinant Human Tryptase alpha/beta 1 His Protein [NBP2-22894]

SDS-Page of Recombinant Human Tryptase alpha/beta 1 His Protein

Formulation, Preparation, and Storage

NBP2-22894
Formulation 20 mM Tris-HCl buffer (pH8.0), 10% glycerol, 0.4M UREA
Preservative No Preservative
Concentration 1 mg/ml
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tryptase alpha/beta 1

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, alpha and beta 1. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq, Jul 2008]

Alternate Names

alpha-Tryptase, EC:3.4.21.59, epididymis secretory sperm binding protein, mast cell alpha II tryptase, mast cell beta I tryptase, mast cell tryptase, TPS1, TPS2, TPSAB1, TPSB1, TPSB2, Tryptase 1, tryptase alpha II, Tryptase alpha-1, tryptase beta I, tryptase beta-1, Tryptase beta-2, Tryptase I, tryptase II, tryptase-1, tryptase-2, tryptase-I, tryptase-III

Gene Symbol

TPSAB1

Additional Tryptase alpha/beta 1 Products

Product Documents for Recombinant Human Tryptase alpha/beta 1 His Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human Tryptase alpha/beta 1 His Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human Tryptase alpha/beta 1 His Protein

There are currently no reviews for this product. Be the first to review Recombinant Human Tryptase alpha/beta 1 His Protein and earn rewards!

Have you used Recombinant Human Tryptase alpha/beta 1 His Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...