Tryptophanyl tRNA synthetase Antibody (3B2F10)
Novus Biologicals | Catalog # NBP3-16419
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 3B2F10 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 3-98 of human Tryptophanyl tRNA synthetase (P23381). NSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGI
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Tryptophanyl tRNA synthetase Antibody (3B2F10)
Western Blot: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419]
Western Blot: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419] - Western blot analysis of extracts of various cell lines, using Tryptophanyl tRNA synthetase Rabbit mAb (NBP3-16419) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunohistochemistry-Paraffin: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419]
Immunohistochemistry-Paraffin: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419] - Immunohistochemistry of paraffin-embedded human placenta using Tryptophanyl tRNA synthetase Rabbit mAb (NBP3-16419) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Applications for Tryptophanyl tRNA synthetase Antibody (3B2F10)
Application
Recommended Usage
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Tryptophanyl tRNA synthetase
Alternate Names
EC 6.1.1, EC 6.1.1.2, GAMMA-2, hWRS, IFI53, IFP53trpRS, Interferon-induced protein 53, TrpRS, tryptophan tRNA ligase 1, cytoplasmic, Tryptophan--tRNA ligase, tryptophanyl-tRNA synthetase, tryptophanyl-tRNA synthetase, cytoplasmic, WRS
Gene Symbol
WARS1
Additional Tryptophanyl tRNA synthetase Products
Product Documents for Tryptophanyl tRNA synthetase Antibody (3B2F10)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Tryptophanyl tRNA synthetase Antibody (3B2F10)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Tryptophanyl tRNA synthetase Antibody (3B2F10)
There are currently no reviews for this product. Be the first to review Tryptophanyl tRNA synthetase Antibody (3B2F10) and earn rewards!
Have you used Tryptophanyl tRNA synthetase Antibody (3B2F10)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...