TSPAN8/TM4SF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62380

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to TSPAN8(tetraspanin 8) The peptide sequence was selected from the middle region of TSPAN8. Peptide sequence VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TSPAN8/TM4SF3 Antibody - BSA Free

Western Blot: TSPAN8/TM4SF3 Antibody [NBP1-62380]

Western Blot: TSPAN8/TM4SF3 Antibody [NBP1-62380]

Western Blot: TM4SF3 Antibody [NBP1-62380] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: TSPAN8/TM4SF3 Antibody [NBP1-62380]

Western Blot: TSPAN8/TM4SF3 Antibody [NBP1-62380]

Western Blot: TM4SF3 Antibody [NBP1-62380] - Expressed in E. coli, concentration 1 ug/ml.

Applications for TSPAN8/TM4SF3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN8

TSPAN8 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN8 is a cell surface glycoprotein that is known to complex with integrins. TSPAN8 is expressed in different carcinomas.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene.

Long Name

Tetraspanin 8/Transmembrane 4 Superfamily, Member 3

Alternate Names

CO-029, TM4SF3

Gene Symbol

TSPAN8

UniProt

Additional TSPAN8 Products

Product Documents for TSPAN8/TM4SF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TSPAN8/TM4SF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for TSPAN8/TM4SF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSPAN8/TM4SF3 Antibody - BSA Free and earn rewards!

Have you used TSPAN8/TM4SF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...