TTLL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-11014

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TTLL3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TTLL3 (NP_001021100). Peptide sequence LKPLPLVGTFQRRRGLGDMKLGKPLLRFPTALVLDPTPNKKKQVKYLGLD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TTLL3 Antibody - BSA Free

Western Blot: TTLL3 Antibody [NBP3-11014]

Western Blot: TTLL3 Antibody [NBP3-11014]

Western Blot: TTLL3 Antibody [NBP3-11014] - Western blot analysis of TTLL3 in Human OVCAR-3 Whole Cell lysates. Antibody dilution at 3ug/ml

Applications for TTLL3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TTLL3

Monoglycylase which modifies alpha- and beta-tubulin, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin. Involved in the side-chain initiation step of the glycylation reaction by adding a single glycine chain to generate monoglycine side chains. Not involved in elongation step of the polyglycylation reaction

Alternate Names

DKFZp686D076, FLJ13898, HOTTL, MGC120530, MGC120532, tubulin tyrosine ligase-like family, member 3

Gene Symbol

TTLL3

Additional TTLL3 Products

Product Documents for TTLL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TTLL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TTLL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TTLL3 Antibody - BSA Free and earn rewards!

Have you used TTLL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies