UBQLN3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54981

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot

Cited:

PCR

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UBQLN3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to UBQLN3(ubiquilin 3) The peptide sequence was selected from the N terminal of UBQLN3. Peptide sequence LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UBQLN3 Antibody - BSA Free

Western Blot: UBQLN3 Antibody [NBP1-54981]

Western Blot: UBQLN3 Antibody [NBP1-54981]

Western Blot: UBQLN3 Antibody [NBP1-54981] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for UBQLN3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBQLN3

UBQLN3 is an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. UBQLN3 is specifically expressed in the testis, and proposed to regulate cell-cycle progression during spermatogenesis. This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This gene is specifically expressed in the testis, and proposed to regulate cell-cycle progression during spermatogenesis.

Alternate Names

TUP-1, ubiquilin 3, ubiquilin-3

Gene Symbol

UBQLN3

UniProt

Q9H347 (Human)

Additional UBQLN3 Products

Product Documents for UBQLN3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UBQLN3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for UBQLN3 Antibody - BSA Free

Customer Reviews for UBQLN3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBQLN3 Antibody - BSA Free and earn rewards!

Have you used UBQLN3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies