UBR2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54982

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to UBR2(ubiquitin protein ligase E3 component n-recognin 2) The peptide sequence was selected from the C terminal of UBR2. Peptide sequence QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

200 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UBR2 Antibody - BSA Free

Western Blot: UBR2 Antibody [NBP1-54982]

Western Blot: UBR2 Antibody [NBP1-54982]

Western Blot: UBR2 Antibody [NBP1-54982] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: UBR2 Antibody [NBP1-54982]

Western Blot: UBR2 Antibody [NBP1-54982]

Western Blot: UBR2 Antibody [NBP1-54982] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for UBR2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBR2

Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognize the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron.Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognize the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron (Kwon et al., 2003 [PubMed 14585983]).[supplied by OMIM].

Alternate Names

bA49A4.1, C6orf133MGC71112, chromosome 6 open reading frame 133, dJ242G1.1, dJ392M17.3, DKFZp686C08114, E3 ubiquitin-protein ligase UBR2, EC 6.3.2.-, KIAA0349FLJ36357, N-recognin-2, RP3-392M17.3, ubiquitin protein ligase E3 component n-recognin 2, Ubiquitin-protein ligase E3-alpha-2, Ubiquitin-protein ligase E3-alpha-II

Gene Symbol

UBR2

UniProt

Additional UBR2 Products

Product Documents for UBR2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBR2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBR2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBR2 Antibody - BSA Free and earn rewards!

Have you used UBR2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...