UGT2A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69615

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UGT2A3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to UGT2A3(UDP glucuronosyltransferase 2 family, polypeptide A3) The peptide sequence was selected from the N terminal of UGT2A3. Peptide sequence NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UGT2A3 Antibody - BSA Free

Western Blot: UGT2A3 Antibody [NBP1-69615]

Western Blot: UGT2A3 Antibody [NBP1-69615]

Western Blot: UGT2A3 Antibody [NBP1-69615] - This Anti-UGT2A3 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Applications for UGT2A3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UGT2A3

UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Alternate Names

EC 2.4.1.17, FLJ21934, UDP glucuronosyltransferase 2 family, polypeptide A3, UDP-glucuronosyltransferase 2A3, UDPGT 2A3

Gene Symbol

UGT2A3

UniProt

Q6UWM9 (Human)

Additional UGT2A3 Products

Product Documents for UGT2A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UGT2A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UGT2A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UGT2A3 Antibody - BSA Free and earn rewards!

Have you used UGT2A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies