UGT2B15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69700

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to UGT2B15(UDP glucuronosyltransferase 2 family, polypeptide B15) The peptide sequence was selected from the N terminal of UGT2B15. Peptide sequence IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UGT2B15 Antibody - BSA Free

Western Blot: UGT2B15 Antibody [NBP1-69700]

Western Blot: UGT2B15 Antibody [NBP1-69700]

Western Blot: UGT2B15 Antibody [NBP1-69700] - This Anti-UGT2B15 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Applications for UGT2B15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UGT2B15

The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. See UGT2B4 (MIM 600067).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1605 AF180322.1 1-1605 1606-1700 U06641.1 1547-1641 1701-1798 U08854.1 1684-1781 1799-1801 U06641.1 1779-1781 1802-1837 U06641.1 1783-1818 1838-1909 U08854.1 1822-1893 1910-2106 AF180322.1 1911-2107 2107-2144 U06641.1 2086-2123

Alternate Names

EC 2.4.1, EC 2.4.1.17, HLUG4, UDP glucuronosyltransferase 2 family, polypeptide B15, UDP glycosyltransferase 2 family, polypeptide B15, UDP glycosyltransferase 2B15, UDP-glucuronosyltransferase 2B15, UDP-glucuronosyltransferase 2B8, UDP-glucuronosyltransferase UGT2B15, UDP-glucuronyltransferase, family 2, beta-15, UDPGT 2B15, UDPGT 2B8, UDPGTH3, UDPGTh-3, UGT2B8UDPGT2B15

Gene Symbol

UGT2B15

UniProt

Additional UGT2B15 Products

Product Documents for UGT2B15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UGT2B15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UGT2B15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UGT2B15 Antibody - BSA Free and earn rewards!

Have you used UGT2B15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...