UNC13D/Munc 13-4 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-57967PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UNC13D/Munc 13-4.

Source: E. coli

Amino Acid Sequence: TEWFHLKQQHHQPMVQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDHTTVVGDVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57967.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-57967PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: UNC13D

Munc 13-4 encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder.

Long Name

UNC-13 Homolog D

Alternate Names

FHL3, HLH3, HPLH3, Munc13-4

Gene Symbol

UNC13D

Additional UNC13D Products

Product Documents for UNC13D/Munc 13-4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UNC13D/Munc 13-4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for UNC13D/Munc 13-4 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review UNC13D/Munc 13-4 Recombinant Protein Antigen and earn rewards!

Have you used UNC13D/Munc 13-4 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for UNC13D/Munc 13-4 Recombinant Protein Antigen

Showing  1 - 11 FAQ Showing All
  • Q: I'm looking Munc13-4 N terminal antibody with related epitope sequence.

    A:

    Unfortunately we do not epitope map our antibodies, but we do have a whole list of antibodies against your target depending on species reactivity and application you want to use them for. Please see this link to our MUNC 13-4 antibodies. All of the immunogen information that is not proprietary, or known should be presented on the datasheet. Often times a range will be provided where the peptide falls within, or if it was raised against a larger recombinant protein as is the case for the one you inquired about we do not know exactly where the binding occurs.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...