URB/CCD80 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86044

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all URB Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human URB/CCD80. Peptide sequence: LRVKQYYEVPITMKSVFDLIDTFQSRIKDMEKQKKEGIVCKEDKKQSLEN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit URB/CCD80 Antibody - BSA Free (NBP2-86044) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for URB/CCD80 Antibody - BSA Free

Western Blot: URB/CCD80 Antibody [NBP2-86044]

Western Blot: URB/CCD80 Antibody [NBP2-86044]

Western Blot: URB/CCD80 Antibody [NBP2-86044] - Host: Rabbit. Target Name: CCDC80. Sample Type: RPMI-8226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for URB/CCD80 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: URB

CCD80 is expressed in dermal papilla and dermal fibroblasts (at protein level) and in heart, thymus, placenta, pancreas, colon, epithelium, spleen and osteoblasts. There are three named isoforms produced by alternative splicing.

Long Name

Up-regulated in BRS-3 Deficient Mouse/Okuribin/Coiled-coil Domain Containing Protein 80

Alternate Names

CCDC80, DRO1, SSG1, Steroid-sensitive protein 1

Gene Symbol

CCDC80

Additional URB Products

Product Documents for URB/CCD80 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for URB/CCD80 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Chondrogenesis Markers

Customer Reviews for URB/CCD80 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review URB/CCD80 Antibody - BSA Free and earn rewards!

Have you used URB/CCD80 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies