URI Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79413

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all URI Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human C19orf2. Peptide sequence NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for URI Antibody - BSA Free

Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413] - MCF7, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that URI1 is expressed in MCF7.
Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413] - Hela, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that URI1 is expressed in HeLa.
Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that URI1 is expressed in HepG2.
Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413]

Western Blot: URI Antibody [NBP1-79413] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for URI Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: URI

RMP [RNA polymerase II subunit 5(RPB5)-mediating protein] interacts with RPB5 to negatively regulate RNA polymerase II transcription. RMP has corepressor activity that is facilitated by its association with DMAP1 (DNA methyltransferase 1-associating protein). RMP appears to be involved in mTOR kinase signaling.

Alternate Names

chromosome 19 open reading frame 2, FLJ10575, NNX3RPB5-mediating protein, Protein NNX3, RMPunconventional prefoldin RPB5 interactor, RNA polymerase II subunit 5-mediating protein, URIRNA polymerase II, subunit 5-mediating protein

Gene Symbol

URI1

Additional URI Products

Product Documents for URI Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for URI Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for URI Antibody - BSA Free

There are currently no reviews for this product. Be the first to review URI Antibody - BSA Free and earn rewards!

Have you used URI Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies