VARS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55365

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to VARS(valyl-tRNA synthetase) The peptide sequence was selected from the middle region of VARS. Peptide sequence AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

140 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for VARS Antibody - BSA Free

Western Blot: VARS Antibody [NBP1-55365]

Western Blot: VARS Antibody [NBP1-55365]

Western Blot: VARS Antibody [NBP1-55365] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for VARS Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VARS

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. The protein encoded by this gene belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

EC 6.1.1, EC 6.1.1.9, G7AVARS1, Protein G7a, valine tRNA ligase 1, cytoplasmic, Valine--tRNA ligase, ValRS, valyl-tRNA synthetase, valyl-tRNA synthetase 2, VARS2valRS

Gene Symbol

VARS1

UniProt

Additional VARS Products

Product Documents for VARS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VARS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VARS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VARS Antibody - BSA Free and earn rewards!

Have you used VARS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...