VCX3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86893

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human VCX3A. Peptide sequence: KKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHEL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for VCX3A Antibody - BSA Free

Western Blot: VCX3A Antibody [NBP2-86893]

Western Blot: VCX3A Antibody [NBP2-86893]

Western Blot: VCX3A Antibody [NBP2-86893] - Host: Rabbit. Target Name: VCX3A. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for VCX3A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VCX3A

VCX3A belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit.

Alternate Names

Variable charge protein on X with eight repeats, variable charge X-linked protein 3, variable charge, X-linked 3A, Variably charged protein X-A, variably charged X-A, VCX3, VCX-8R, VCX8RMGC125730, VCX-8rvariable charge, X-linked 3, VCX-AMGC118976, VCXAMGC125796

Gene Symbol

VCX3A

Additional VCX3A Products

Product Documents for VCX3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VCX3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VCX3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VCX3A Antibody - BSA Free and earn rewards!

Have you used VCX3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...