WAC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86061

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all WAC Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human WAC. Peptide sequence: RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKML The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for WAC Antibody - BSA Free

Western Blot: WAC Antibody [NBP2-86061]

Western Blot: WAC Antibody [NBP2-86061]

Western Blot: WAC Antibody [NBP2-86061] - Host: Rabbit. Target Name: WAC. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for WAC Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WAC

WAC is encoded by this gene contains a WW domain, which is a protein module found in a wide range of signaling proteins. This domain mediates protein-protein interactions and binds proteins containing short linear peptide motifs that are proline-rich or contain at least one proline. This gene product shares 94% sequence identity with the WAC protein in mouse, however, its exact function is not known. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Alternate Names

1110067P07Rik, bA48B24, bA48B24.1, BM-016, FLJ31290, KIAA1844, MGC10753, PRO1741, WW domain containing adaptor with coiled-coil, WW domain-containing adapter protein with coiled-coil, WW domain-containing adaptor with coiled coil, Wwp4

Gene Symbol

WAC

Additional WAC Products

Product Documents for WAC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WAC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WAC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WAC Antibody - BSA Free and earn rewards!

Have you used WAC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies