WARS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54653

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WARS2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to WARS2(tryptophanyl tRNA synthetase 2, mitochondrial) The peptide sequence was selected from the middle region of WARS2. Peptide sequence TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for WARS2 Antibody - BSA Free

Western Blot: WARS2 Antibody [NBP1-54653]

Western Blot: WARS2 Antibody [NBP1-54653]

Western Blot: WARS2 Antibody [NBP1-54653] - Sample Tissue: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
Western Blot: WARS2 Antibody [NBP1-54653]

Western Blot: WARS2 Antibody [NBP1-54653]

Western Blot: WARS2 Antibody [NBP1-54653] - Human Fetal Muscle. Lane A: Primary Antibody. Lane B: Primary Antibody and Blocking Peptide.
Western Blot: WARS2 Antibody [NBP1-54653]

Western Blot: WARS2 Antibody [NBP1-54653]

Western Blot: WARS2 Antibody [NBP1-54653] - Human Muscle lysate, concentration 0.2-1 ug/ml.
WARS2 Antibody

Immunocytochemistry/ Immunofluorescence: WARS2 Antibody [NBP1-54653] -

Immunocytochemistry/ Immunofluorescence: WARS2 Antibody [NBP1-54653] - WARS2 regulates endothelial cell morphology & angiogenic potential.(a) Bright field micrographs of endothelial cells (ECs) following transfection with either control siRNA (siNT) or siRNA against WARS2 (siWARS2). Scale bar=200 μm. (b) Confocal microscopy of ECs transfected with siNT or siWARS2 (red, mitochondria; green, actin; blue, nucleus; scale bar =30 μm). (c) EC number in EC cultures transfected with siNT or siWARS2 (n=3 per condition, t-test). (d) Super-resolution microscopy of ECs transfected with siNT or siWARS2 & stained for actin (left), mitochondria (middle) & composite images with nuclear stain (right). Scale bar =25 μm. (e–j) Effects of WARS2 in an in vitro model of EC angiogenesis. (e–g) WARS2 loss of function; (h–j) WARS2 gain-of-function. Total tubes (e, h), total tube length (in pixel) (f, i) & total branching points (g, j). n=8, t-test. **, P<0.01; ***, P<0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27389904), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
WARS2 Antibody

Immunocytochemistry/ Immunofluorescence: WARS2 Antibody [NBP1-54653] -

Immunocytochemistry/ Immunofluorescence: WARS2 Antibody [NBP1-54653] - WARS2 regulates endothelial cell morphology & angiogenic potential.(a) Bright field micrographs of endothelial cells (ECs) following transfection with either control siRNA (siNT) or siRNA against WARS2 (siWARS2). Scale bar=200 μm. (b) Confocal microscopy of ECs transfected with siNT or siWARS2 (red, mitochondria; green, actin; blue, nucleus; scale bar =30 μm). (c) EC number in EC cultures transfected with siNT or siWARS2 (n=3 per condition, t-test). (d) Super-resolution microscopy of ECs transfected with siNT or siWARS2 & stained for actin (left), mitochondria (middle) & composite images with nuclear stain (right). Scale bar =25 μm. (e–j) Effects of WARS2 in an in vitro model of EC angiogenesis. (e–g) WARS2 loss of function; (h–j) WARS2 gain-of-function. Total tubes (e, h), total tube length (in pixel) (f, i) & total branching points (g, j). n=8, t-test. **, P<0.01; ***, P<0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27389904), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for WARS2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WARS2

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase. Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described.

Alternate Names

(Mt)TrpRS, EC 6.1.1, EC 6.1.1.2, TrpRStryptophan-tRNA ligase, tryptophan tRNA ligase 2, mitochondrial, Tryptophan--tRNA ligase, tryptophanyl tRNA synthetase 2, mitochondrial, tryptophanyl-tRNA synthetase, mitochondrial

Gene Symbol

WARS2

UniProt

Q9UGM6 (Human)

Additional WARS2 Products

Product Documents for WARS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WARS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for WARS2 Antibody - BSA Free

Customer Reviews for WARS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WARS2 Antibody - BSA Free and earn rewards!

Have you used WARS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies